Apoptosis repressor with CARD (NOL3) (NM_003946) Human Recombinant Protein
CAT#: TP300591
Recombinant protein of human nucleolar protein 3 (apoptosis repressor with CARD domain) (NOL3), 20 µg
View other "Apoptosis repressor with CARD" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200591 protein sequence
Red=Cloning site Green=Tags(s) MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGE AACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPE GSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 22.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003937 |
| Locus ID | 8996 |
| UniProt ID | O60936 |
| Refseq Size | 1540 |
| Cytogenetics | 16q22.1 |
| Refseq ORF | 624 |
| Synonyms | ARC; FCM; MYOCL1; MYP; NOP; NOP30 |
| Summary | This gene encodes an anti-apoptotic protein that has been shown to down-regulate the enzyme activities of caspase 2, caspase 8 and tumor protein p53. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401296 | NOL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401296 | Transient overexpression lysate of nucleolar protein 3 (apoptosis repressor with CARD domain) (NOL3) |
CNY 3080.00 |
|
| PH300591 | NOL3 MS Standard C13 and N15-labeled recombinant protein (NP_003937) |
CNY 19520.00 |
|
| TP720132 | Recombinant protein of human nucleolar protein 3 (apoptosis repressor with CARD domain) (NOL3), transcript variant 3. |
CNY 1800.00 |
其它Apoptosis repressor with CARD产品
