Apoptosis repressor with CARD (NOL3) (NM_003946) Human Mass Spec Standard
CAT#: PH300591
NOL3 MS Standard C13 and N15-labeled recombinant protein (NP_003937)
View other "Apoptosis repressor with CARD" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | NOL3 MS Standard C13 and N15-labeled recombinant protein (NP_003937) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200591 |
| Predicted MW | 22.6 kDa |
| Protein Sequence |
>RC200591 protein sequence
Red=Cloning site Green=Tags(s) MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGE AACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPE GSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003937 |
| RefSeq Size | 1540 |
| RefSeq ORF | 624 |
| Synonyms | ARC; FCM; MYOCL1; MYP; NOP; NOP30 |
| Locus ID | 8996 |
| Cytogenetics | 16q22.1 |
| Summary | This gene encodes an anti-apoptotic protein that has been shown to down-regulate the enzyme activities of caspase 2, caspase 8 and tumor protein p53. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401296 | NOL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401296 | Transient overexpression lysate of nucleolar protein 3 (apoptosis repressor with CARD domain) (NOL3) |
CNY 3080.00 |
|
| TP300591 | Recombinant protein of human nucleolar protein 3 (apoptosis repressor with CARD domain) (NOL3), 20 µg |
CNY 2900.00 |
|
| TP720132 | Recombinant protein of human nucleolar protein 3 (apoptosis repressor with CARD domain) (NOL3), transcript variant 3. |
CNY 1800.00 |
其它Apoptosis repressor with CARD产品
