RFC4 (NM_002916) Human Recombinant Protein
CAT＃: TP300426
Recombinant protein of human replication factor C (activator 1) 4, 37kDa (RFC4), transcript variant 1, 20 µg
View other "RFC4" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200426 protein sequence
Red=Cloning site Green=Tags(s) MQAFLKGTSISTKPPLTKDRGVAASAGSSGENKKAKPVPWVEKYRPKCVDEVAFQEEVVAVLKKSLEGAD LPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVREKVKNFAQLTVSGSRSDGKP CPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSDKIQQQR LLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATRLTGGKEITEKVITDIAGVIPAEKIDGVFAA CQSGSFDKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLIS LCATVMQQLSQNC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 39.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002907 |
| Locus ID | 5984 |
| UniProt ID | P35249 |
| Refseq Size | 1427 |
| Cytogenetics | 3q27.3 |
| Refseq ORF | 1089 |
| Synonyms | A1; RFC37 |
| Summary | The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kD. This gene encodes the 37 kD subunit. This subunit forms a core complex with the 36 and 40 kDa subunits. The core complex possesses DNA-dependent ATPase activity, which was found to be stimulated by PCNA in an in vitro system. Alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Stem cell - Pluripotency |
| Protein Pathways | DNA replication, Mismatch repair, Nucleotide excision repair |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405706 | RFC4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419019 | RFC4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405706 | Transient overexpression lysate of replication factor C (activator 1) 4, 37kDa (RFC4), transcript variant 2 |
CNY 3080.00 |
|
| LY419019 | Transient overexpression lysate of replication factor C (activator 1) 4, 37kDa (RFC4), transcript variant 1 |
CNY 3080.00 |
|
| PH300426 | RFC4 MS Standard C13 and N15-labeled recombinant protein (NP_002907) |
CNY 19520.00 |
|
| PH311392 | RFC4 MS Standard C13 and N15-labeled recombinant protein (NP_853551) |
CNY 19520.00 |
|
| TP311392 | Recombinant protein of human replication factor C (activator 1) 4, 37kDa (RFC4), transcript variant 2, 20 µg |
CNY 2900.00 |
