RFC4 (NM_181573) Human Mass Spec Standard
CAT#: PH311392
RFC4 MS Standard C13 and N15-labeled recombinant protein (NP_853551)
View other "RFC4" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | RFC4 MS Standard C13 and N15-labeled recombinant protein (NP_853551) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC211392 |
| Predicted MW | 39.5 kDa |
| Protein Sequence |
>RC211392 representing NM_181573
Red=Cloning site Green=Tags(s) MQAFLKGTSISTKPPLTKDRGVAASAGSSGENKKAKPVPWVEKYRPKCVDEVAFQEEVVAVLKKSLEGAD LPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVREKVKNFAQLTVSGSRSDGKP CPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSDKIQQQR LLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATRLTGGKEITEKVITDIAGVIPAEKIDGVFAA CQSGSFDKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLIS LCATVMQQLSQNC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_853551 |
| RefSeq Size | 1395 |
| RefSeq ORF | 1089 |
| Synonyms | A1; RFC37 |
| Locus ID | 5984 |
| Cytogenetics | 3q27.3 |
| Summary | The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kD. This gene encodes the 37 kD subunit. This subunit forms a core complex with the 36 and 40 kDa subunits. The core complex possesses DNA-dependent ATPase activity, which was found to be stimulated by PCNA in an in vitro system. Alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Stem cell - Pluripotency |
| Protein Pathways | DNA replication, Mismatch repair, Nucleotide excision repair |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405706 | RFC4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419019 | RFC4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405706 | Transient overexpression lysate of replication factor C (activator 1) 4, 37kDa (RFC4), transcript variant 2 |
CNY 3080.00 |
|
| LY419019 | Transient overexpression lysate of replication factor C (activator 1) 4, 37kDa (RFC4), transcript variant 1 |
CNY 3080.00 |
|
| PH300426 | RFC4 MS Standard C13 and N15-labeled recombinant protein (NP_002907) |
CNY 19520.00 |
|
| TP300426 | Recombinant protein of human replication factor C (activator 1) 4, 37kDa (RFC4), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP311392 | Recombinant protein of human replication factor C (activator 1) 4, 37kDa (RFC4), transcript variant 2, 20 µg |
CNY 2900.00 |
