DGCR6L (NM_033257) Human Recombinant Protein
CAT#: TP300317
Recombinant protein of human DiGeorge syndrome critical region gene 6-like (DGCR6L), 20 µg
View other "DGCR6L" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200317 protein sequence
Red=Cloning site Green=Tags(s) MERYAAALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEI QHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVVQAAQQRELEAVEHRIREEQRAMDQK IILELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCRAGNAALGLGGPWQSPAAQ CDQKGSPVPP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 24.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_150282 |
| Locus ID | 85359 |
| UniProt ID | Q9BY27 |
| Refseq Size | 1217 |
| Cytogenetics | 22q11.21 |
| Refseq ORF | 660 |
| Synonyms | DGCR6 |
| Summary | This gene, the result of a duplication at this locus, is one of two functional genes encoding nearly identical proteins that have similar expression patterns. The product of this gene is a protein that shares homology with the Drosophila gonadal protein, expressed in gonadal tissues and germ cells, and with the human laminin gamma-1 chain that functions in cell attachment and migration. This gene is located in a region of chromosome 22 implicated in the DiGeorge syndrome, one facet of a broader collection of anomalies referred to as the CATCH 22 syndrome. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409631 | DGCR6L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409631 | Transient overexpression lysate of DiGeorge syndrome critical region gene 6-like (DGCR6L) |
CNY 3080.00 |
|
| PH300317 | DGCR6L MS Standard C13 and N15-labeled recombinant protein (NP_150282) |
CNY 19520.00 |


