DGCR6L (NM_033257) Human Mass Spec Standard
CAT#: PH300317
DGCR6L MS Standard C13 and N15-labeled recombinant protein (NP_150282)
View other "DGCR6L" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | DGCR6L MS Standard C13 and N15-labeled recombinant protein (NP_150282) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200317 |
Predicted MW | 24.9 kDa |
Protein Sequence |
>RC200317 protein sequence
Red=Cloning site Green=Tags(s) MERYAAALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEI QHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVVQAAQQRELEAVEHRIREEQRAMDQK IILELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCRAGNAALGLGGPWQSPAAQ CDQKGSPVPP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_150282 |
RefSeq Size | 1217 |
RefSeq ORF | 660 |
Synonyms | DGCR6 |
Locus ID | 85359 |
Cytogenetics | 22q11.21 |
Summary | This gene, the result of a duplication at this locus, is one of two functional genes encoding nearly identical proteins that have similar expression patterns. The product of this gene is a protein that shares homology with the Drosophila gonadal protein, expressed in gonadal tissues and germ cells, and with the human laminin gamma-1 chain that functions in cell attachment and migration. This gene is located in a region of chromosome 22 implicated in the DiGeorge syndrome, one facet of a broader collection of anomalies referred to as the CATCH 22 syndrome. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409631 | DGCR6L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409631 | Transient overexpression lysate of DiGeorge syndrome critical region gene 6-like (DGCR6L) |
CNY 3080.00 |
|
TP300317 | Recombinant protein of human DiGeorge syndrome critical region gene 6-like (DGCR6L), 20 µg |
CNY 2900.00 |