TRK fused gene (TFG) (NM_001007565) Human Recombinant Protein
CAT#: TP300293
Recombinant protein of human TRK-fused gene (TFG), transcript variant 2, 20 µg
View other "TRK fused gene" proteins (5)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 2700.00
                                                
                                            
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC200293 protein sequence 
Red=Cloning site Green=Tags(s) MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKDEDGDLITIFD SSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDT VDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKNVMSAFGLTDDQVSGPPSAPAEDRSGTPDSI ASSSSAAHPPGVQPQQPPYTGAQTQAGQIEGQMYQQYQQQAGYGAQQPQAPPQQPQQYGIQYSASYSQQT GPQQPQQFQGYGQQPTSQAPAPAFSGQPQQLPAQPPQQYQASNYPAQTYTAQTSQPTNYTVAPASQPGMA PSQPGAYQPRPGFTSLPGSTMTPPPSGPNPYARNRPPFGQGYTQPGPGYR myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 43.3 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_001007566 | 
| Locus ID | 10342 | 
| UniProt ID | Q92734 | 
| Refseq Size | 1841 | 
| Cytogenetics | 3q12.2 | 
| Refseq ORF | 1200 | 
| Synonyms | HMSNP; SPG57; TF6; TRKT3 | 
| Summary | There are several documented fusion oncoproteins encoded partially by this gene. This gene also participates in several oncogenic rearrangements resulting in anaplastic lymphoma and mixoid chondrosarcoma, and may play a role in the NF-kappaB pathway. Multiple transcript variants have been found for this gene. [provided by RefSeq, Sep 2010] | 
| Protein Pathways | Pathways in cancer, Thyroid cancer | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC401827 | TFG HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC423514 | TFG HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY401827 | Transient overexpression lysate of TRK-fused gene (TFG), transcript variant 1 | 
                                                     CNY 3080.00  | 
                                            |
| LY423514 | Transient overexpression lysate of TRK-fused gene (TFG), transcript variant 2 | 
                                                     CNY 3080.00  | 
                                            |
| PH300293 | TFG MS Standard C13 and N15-labeled recombinant protein (NP_001007566) | 
                                                     CNY 19520.00  | 
                                            
其它TRK fused gene产品
