TRK fused gene (TFG) (NM_001007565) Human Mass Spec Standard
CAT#: PH300293
TFG MS Standard C13 and N15-labeled recombinant protein (NP_001007566)
View other "TRK fused gene" proteins (5)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 2700.00
                                                
                                            
Specifications
| Product Data | |
| Description | TFG MS Standard C13 and N15-labeled recombinant protein (NP_001007566) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC200293 | 
| Predicted MW | 43.4 kDa | 
| Protein Sequence | 
                 >RC200293 protein sequence 
Red=Cloning site Green=Tags(s) MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKDEDGDLITIFD SSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDT VDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKNVMSAFGLTDDQVSGPPSAPAEDRSGTPDSI ASSSSAAHPPGVQPQQPPYTGAQTQAGQIEGQMYQQYQQQAGYGAQQPQAPPQQPQQYGIQYSASYSQQT GPQQPQQFQGYGQQPTSQAPAPAFSGQPQQLPAQPPQQYQASNYPAQTYTAQTSQPTNYTVAPASQPGMA PSQPGAYQPRPGFTSLPGSTMTPPPSGPNPYARNRPPFGQGYTQPGPGYR myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_001007566 | 
| RefSeq Size | 1841 | 
| RefSeq ORF | 1200 | 
| Synonyms | HMSNP; SPG57; TF6; TRKT3 | 
| Locus ID | 10342 | 
| Cytogenetics | 3q12.2 | 
| Summary | There are several documented fusion oncoproteins encoded partially by this gene. This gene also participates in several oncogenic rearrangements resulting in anaplastic lymphoma and mixoid chondrosarcoma, and may play a role in the NF-kappaB pathway. Multiple transcript variants have been found for this gene. [provided by RefSeq, Sep 2010] | 
| Protein Pathways | Pathways in cancer, Thyroid cancer | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC401827 | TFG HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC423514 | TFG HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY401827 | Transient overexpression lysate of TRK-fused gene (TFG), transcript variant 1 | 
                                                     CNY 3080.00  | 
                                            |
| LY423514 | Transient overexpression lysate of TRK-fused gene (TFG), transcript variant 2 | 
                                                     CNY 3080.00  | 
                                            |
| TP300293 | Recombinant protein of human TRK-fused gene (TFG), transcript variant 2, 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            
其它TRK fused gene产品
