Calnexin (CANX) (NM_001746) Human Recombinant Protein
CAT#: TP300229
Recombinant protein of human calnexin (CANX), transcript variant 1, 20 µg
View other "Calnexin" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200229 protein sequence
Red=Cloning site Green=Tags(s) MEGKWLLCMLLVLGTAIVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVY FADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVEEMKESKLPGDKGLVLMSRAKHHAISAKLNKPFL FDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPK TGIYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPE DRKPEDWDERPKIPDPEAVKPDDWDEDAPAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEW EAPQIANPRCESAPGCGVWQRPVIDNPNYKGKWKPPMIDNPSYQGIWKPRKIPNPDFFEDLEPFRMTPFS AIGLELWSMTSDIFFDNFIICADRRIVDDWANDGWGLKKAADGAAEPGVVGQMIEAAEERPWLWVVYILT VALPVFLVILFCCSGKKQTSGMEYKKTDAPQPDVKEEEEEKEEEKDKGDEEEEGEEKLEEKQKSDAEEDG GTVSQEEEDRKPKAEEDEILNRSPRNRKPRRE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 65.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001737 |
| Locus ID | 821 |
| UniProt ID | P27824 |
| Refseq Size | 4953 |
| Cytogenetics | 5q35.3 |
| Refseq ORF | 1776 |
| Synonyms | CNX; IP90; P90 |
| Summary | This gene encodes a member of the calnexin family of molecular chaperones. The encoded protein is a calcium-binding, endoplasmic reticulum (ER)-associated protein that interacts transiently with newly synthesized N-linked glycoproteins, facilitating protein folding and assembly. It may also play a central role in the quality control of protein folding by retaining incorrectly folded protein subunits within the ER for degradation. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jun 2018] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Antigen processing and presentation |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419769 | CANX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422525 | CANX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419769 | Transient overexpression lysate of calnexin (CANX), transcript variant 1 |
CNY 3080.00 |
|
| LY422525 | Transient overexpression lysate of calnexin (CANX), transcript variant 2 |
CNY 3080.00 |
|
| PH300229 | CANX MS Standard C13 and N15-labeled recombinant protein (NP_001737) |
CNY 19520.00 |
|
| TP760886 | Purified recombinant protein of Human calnexin (CANX), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
其它Calnexin产品

