Calnexin (CANX) (NM_001746) Human Mass Spec Standard
CAT#: PH300229
CANX MS Standard C13 and N15-labeled recombinant protein (NP_001737)
View other "Calnexin" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
| Cited in 2 publications. |
Specifications
| Product Data | |
| Description | CANX MS Standard C13 and N15-labeled recombinant protein (NP_001737) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200229 |
| Predicted MW | 67.6 kDa |
| Protein Sequence |
>RC200229 protein sequence
Red=Cloning site Green=Tags(s) MEGKWLLCMLLVLGTAIVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVY FADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVEEMKESKLPGDKGLVLMSRAKHHAISAKLNKPFL FDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPK TGIYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPE DRKPEDWDERPKIPDPEAVKPDDWDEDAPAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEW EAPQIANPRCESAPGCGVWQRPVIDNPNYKGKWKPPMIDNPSYQGIWKPRKIPNPDFFEDLEPFRMTPFS AIGLELWSMTSDIFFDNFIICADRRIVDDWANDGWGLKKAADGAAEPGVVGQMIEAAEERPWLWVVYILT VALPVFLVILFCCSGKKQTSGMEYKKTDAPQPDVKEEEEEKEEEKDKGDEEEEGEEKLEEKQKSDAEEDG GTVSQEEEDRKPKAEEDEILNRSPRNRKPRRE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001737 |
| RefSeq Size | 4953 |
| RefSeq ORF | 1776 |
| Synonyms | CNX; IP90; P90 |
| Locus ID | 821 |
| Cytogenetics | 5q35.3 |
| Summary | This gene encodes a member of the calnexin family of molecular chaperones. The encoded protein is a calcium-binding, endoplasmic reticulum (ER)-associated protein that interacts transiently with newly synthesized N-linked glycoproteins, facilitating protein folding and assembly. It may also play a central role in the quality control of protein folding by retaining incorrectly folded protein subunits within the ER for degradation. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jun 2018] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Antigen processing and presentation |
Citations (2)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Non-invasive intravital imaging of cellular differentiation with a bright red-excitable fluorescent protein
,null,
Nature methods
,PubMed ID 24633408
[CANX]
|
|
A bright monomeric green fluorescent protein derived from Branchiostoma lanceolatum
,null,
Nature methods
,PubMed ID 23524392
[CANX]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419769 | CANX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422525 | CANX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419769 | Transient overexpression lysate of calnexin (CANX), transcript variant 1 |
CNY 3080.00 |
|
| LY422525 | Transient overexpression lysate of calnexin (CANX), transcript variant 2 |
CNY 3080.00 |
|
| TP300229 | Recombinant protein of human calnexin (CANX), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP760886 | Purified recombinant protein of Human calnexin (CANX), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
其它Calnexin产品

