HAUS4 (NM_017815) Human Recombinant Protein
CAT#: TP300173
Recombinant protein of human chromosome 14 open reading frame 94 (C14orf94), 20 µg
View other "HAUS4" proteins (7)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC200173 protein sequence 
Red=Cloning site Green=Tags(s) MASGDFCSPGEGMEILQQVCSKQLPPCNLSKEDLLQNPYFSKLLLNLSQHVDESGLSLTLAKEQAQAWKE VRLHKTTWLRSEILHRVIQELLVDYYVKIQDTNVTSEDKKFHETLEQRLLVTELMRLLGPSQEREIPPLL GLEKADLLELMPLSEDFVWMRARLQQEVEEQLKKKCFTLLCYYDPNSDADSETVKAAKVWKLAEVLVGEQ QQCQDAKSQQKEQMLLLEKKSAAYSQVLLRCLTLLQRLLQEHRLKTQSELDRINAQYLEVKCGAMILKLR MEELKILSDTYTVEKVEVHRLIRDRLEGAIHLQEQDMENSRQVLNSYEVLGEEFDRLVKEYTVLKQATEN KRWALQEFSKVYR myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 42.2 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_060285 | 
| Locus ID | 54930 | 
| UniProt ID | Q9H6D7 | 
| Refseq Size | 1649 | 
| Cytogenetics | 14q11.2 | 
| Refseq ORF | 1089 | 
| Synonyms | C14orf94 | 
| Summary | This gene encodes a subunit of the centrosome complex termed the human augmin complex. The encoded protein localizes to the spindle microtubules and may play a role in mitotic spindle assembly and maintenance of centrosome integrity during cell division. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 1. [provided by RefSeq, Oct 2009] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC413524 | HAUS4 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC432875 | HAUS4 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC432946 | HAUS4 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY413524 | Transient overexpression lysate of HAUS augmin-like complex, subunit 4 (HAUS4), transcript variant 2 | 
                                                     CNY 3080.00  | 
                                            |
| LY432875 | Transient overexpression lysate of HAUS augmin-like complex, subunit 4 (HAUS4), transcript variant 3 | 
                                                     CNY 3080.00  | 
                                            |
| LY432946 | Transient overexpression lysate of HAUS augmin-like complex, subunit 4 (HAUS4), transcript variant 1 | 
                                                     CNY 3080.00  | 
                                            |
| PH300173 | HAUS4 MS Standard C13 and N15-labeled recombinant protein (NP_060285) | 
                                                     CNY 19520.00  | 
                                            
