HAUS4 (NM_017815) Human Mass Spec Standard
CAT＃: PH300173
HAUS4 MS Standard C13 and N15-labeled recombinant protein (NP_060285)
View other "HAUS4" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 3080.00
Specifications
| Product Data | |
| Description | HAUS4 MS Standard C13 and N15-labeled recombinant protein (NP_060285) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200173 |
| Predicted MW | 42.4 kDa |
| Protein Sequence |
>RC200173 protein sequence
Red=Cloning site Green=Tags(s) MASGDFCSPGEGMEILQQVCSKQLPPCNLSKEDLLQNPYFSKLLLNLSQHVDESGLSLTLAKEQAQAWKE VRLHKTTWLRSEILHRVIQELLVDYYVKIQDTNVTSEDKKFHETLEQRLLVTELMRLLGPSQEREIPPLL GLEKADLLELMPLSEDFVWMRARLQQEVEEQLKKKCFTLLCYYDPNSDADSETVKAAKVWKLAEVLVGEQ QQCQDAKSQQKEQMLLLEKKSAAYSQVLLRCLTLLQRLLQEHRLKTQSELDRINAQYLEVKCGAMILKLR MEELKILSDTYTVEKVEVHRLIRDRLEGAIHLQEQDMENSRQVLNSYEVLGEEFDRLVKEYTVLKQATEN KRWALQEFSKVYR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_060285 |
| RefSeq Size | 1649 |
| RefSeq ORF | 1089 |
| Synonyms | C14orf94 |
| Locus ID | 54930 |
| Cytogenetics | 14q11.2 |
| Summary | This gene encodes a subunit of the centrosome complex termed the human augmin complex. The encoded protein localizes to the spindle microtubules and may play a role in mitotic spindle assembly and maintenance of centrosome integrity during cell division. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 1. [provided by RefSeq, Oct 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413524 | HAUS4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432875 | HAUS4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432946 | HAUS4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413524 | Transient overexpression lysate of HAUS augmin-like complex, subunit 4 (HAUS4), transcript variant 2 |
CNY 3080.00 |
|
| LY432875 | Transient overexpression lysate of HAUS augmin-like complex, subunit 4 (HAUS4), transcript variant 3 |
CNY 3080.00 |
|
| LY432946 | Transient overexpression lysate of HAUS augmin-like complex, subunit 4 (HAUS4), transcript variant 1 |
CNY 3080.00 |
|
| TP300173 | Recombinant protein of human chromosome 14 open reading frame 94 (C14orf94), 20 µg |
CNY 2900.00 |
