NTAL (LAT2) (NM_032463) Human Recombinant Protein
CAT#: TP300102
Recombinant protein of human linker for activation of T cells family, member 2 (LAT2), transcript variant 2, 20 µg
View other "NTAL" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200102 protein sequence
Red=Cloning site Green=Tags(s) MSSGTELLWPGAALLVLLGVAASLCVRCSRPGAKRSEKIYQQRSLREDQQSFTGSRTYSLVGQAWPGPLA DMAPTRKDKLLQFYPSLEDPASSRYQNFSKGSRHGSEEAYIDPIAMEYYNWGRFSKPPEDDDANSYENVL ICKQKTTETGAQQEGIGGLCRGDLSLSLALKTGPTSGLCPSASPEEDEESEDYQNSASIHQWRESRKVMG QLQREASPGPVGSPDEEDGEPDYVNGEVAATEA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_115852 |
Locus ID | 7462 |
UniProt ID | Q9GZY6 |
Refseq Size | 2129 |
Cytogenetics | 7q11.23 |
Refseq ORF | 729 |
Synonyms | HSPC046; LAB; NTAL; WBSCR5; WBSCR15; WSCR5 |
Summary | This gene is one of the contiguous genes at 7q11.23 commonly deleted in Williams syndrome, a multisystem developmental disorder. This gene consists of at least 14 exons, and its alternative splicing generates 3 transcript variants, all encoding the same protein. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410097 | LAT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC410098 | LAT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC415475 | LAT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410097 | Transient overexpression lysate of linker for activation of T cells family, member 2 (LAT2), transcript variant 2 |
CNY 3080.00 |
|
LY410098 | Transient overexpression lysate of linker for activation of T cells family, member 2 (LAT2), transcript variant 1 |
CNY 3080.00 |
|
LY415475 | Transient overexpression lysate of linker for activation of T cells family, member 2 (LAT2), transcript variant 3 |
CNY 3080.00 |
|
PH300102 | LAT2 MS Standard C13 and N15-labeled recombinant protein (NP_115852) |
CNY 19520.00 |