NTAL (LAT2) (NM_032463) Human Mass Spec Standard
CAT＃: PH300102
LAT2 MS Standard C13 and N15-labeled recombinant protein (NP_115852)
View other "NTAL" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | LAT2 MS Standard C13 and N15-labeled recombinant protein (NP_115852) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200102 |
| Predicted MW | 26.6 kDa |
| Protein Sequence |
>RC200102 protein sequence
Red=Cloning site Green=Tags(s) MSSGTELLWPGAALLVLLGVAASLCVRCSRPGAKRSEKIYQQRSLREDQQSFTGSRTYSLVGQAWPGPLA DMAPTRKDKLLQFYPSLEDPASSRYQNFSKGSRHGSEEAYIDPIAMEYYNWGRFSKPPEDDDANSYENVL ICKQKTTETGAQQEGIGGLCRGDLSLSLALKTGPTSGLCPSASPEEDEESEDYQNSASIHQWRESRKVMG QLQREASPGPVGSPDEEDGEPDYVNGEVAATEA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_115852 |
| RefSeq Size | 2129 |
| RefSeq ORF | 729 |
| Synonyms | HSPC046; LAB; NTAL; WBSCR5; WBSCR15; WSCR5 |
| Locus ID | 7462 |
| Cytogenetics | 7q11.23 |
| Summary | This gene is one of the contiguous genes at 7q11.23 commonly deleted in Williams syndrome, a multisystem developmental disorder. This gene consists of at least 14 exons, and its alternative splicing generates 3 transcript variants, all encoding the same protein. [provided by RefSeq, Jul 2008] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410097 | LAT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC410098 | LAT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC415475 | LAT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410097 | Transient overexpression lysate of linker for activation of T cells family, member 2 (LAT2), transcript variant 2 |
CNY 3080.00 |
|
| LY410098 | Transient overexpression lysate of linker for activation of T cells family, member 2 (LAT2), transcript variant 1 |
CNY 3080.00 |
|
| LY415475 | Transient overexpression lysate of linker for activation of T cells family, member 2 (LAT2), transcript variant 3 |
CNY 3080.00 |
|
| TP300102 | Recombinant protein of human linker for activation of T cells family, member 2 (LAT2), transcript variant 2, 20 µg |
CNY 2900.00 |
