TEX264 (NM_015926) Human Recombinant Protein
CAT#: TP300008
Recombinant protein of human testis expressed 264 (TEX264), transcript variant 1, 20 µg
View other "TEX264" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200008 protein sequence
Red=Cloning site Green=Tags(s) MSDLLLLGLIGGLTLLLLLTLLAFAGYSGLLAGVEVSAGSPPIRNVTVAYKFHMGLYGETGRLFTESCSI SPKLRSIAVYYDNPHMVPPDKCRCAVGSILSEGEESPSPELIDLYQKFGFKVFSFPAPSHVVTATFPYTT ILSIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPLARQGDFYVPEMKETEWKWRGLVEAID TQVDGTGADTMSDTSSVSLEVSPGSRETSAATLSPGASSRGWDDGDTRSEHSYSESGASGSSFEELDLEG EGPLGESRLDPGTEPLGTTKWLWEPTAPEKGKE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 34 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_057010 |
| Locus ID | 51368 |
| UniProt ID | Q9Y6I9 |
| Refseq Size | 1403 |
| Cytogenetics | 3p21.2 |
| Refseq ORF | 939 |
| Synonyms | ZSIG11 |
| Summary | Major reticulophagy (also called ER-phagy) receptor that acts independently of other candidate reticulophagy receptors to remodel subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover (PubMed:31006538, PubMed:31006537). The ATG8-containing isolation membrane (IM) cradles a tubular segment of TEX264-positive ER near a three-way junction, allowing the formation of a synapse of 2 juxtaposed membranes with trans interaction between the TEX264 and ATG8 proteins (PubMed:31006537). Expansion of the IM would extend the capture of ER, possibly through a 'zipper-like' process involving continued trans TEX264-ATG8 interactions, until poorly understood mechanisms lead to the fission of relevant membranes and, ultimately, autophagosomal membrane closure (PubMed:31006537).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Secreted Protein, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414327 | TEX264 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427069 | TEX264 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414327 | Transient overexpression lysate of testis expressed 264 (TEX264), transcript variant 1 |
CNY 3080.00 |
|
| LY427069 | Transient overexpression lysate of testis expressed 264 (TEX264), transcript variant 2 |
CNY 3080.00 |
|
| PH300008 | TEX264 MS Standard C13 and N15-labeled recombinant protein (NP_057010) |
CNY 19520.00 |
