TEX264 (NM_015926) Human Mass Spec Standard
CAT#: PH300008
TEX264 MS Standard C13 and N15-labeled recombinant protein (NP_057010)
View other "TEX264" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TEX264 MS Standard C13 and N15-labeled recombinant protein (NP_057010) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200008 |
| Predicted MW | 34.2 kDa |
| Protein Sequence |
>RC200008 protein sequence
Red=Cloning site Green=Tags(s) MSDLLLLGLIGGLTLLLLLTLLAFAGYSGLLAGVEVSAGSPPIRNVTVAYKFHMGLYGETGRLFTESCSI SPKLRSIAVYYDNPHMVPPDKCRCAVGSILSEGEESPSPELIDLYQKFGFKVFSFPAPSHVVTATFPYTT ILSIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPLARQGDFYVPEMKETEWKWRGLVEAID TQVDGTGADTMSDTSSVSLEVSPGSRETSAATLSPGASSRGWDDGDTRSEHSYSESGASGSSFEELDLEG EGPLGESRLDPGTEPLGTTKWLWEPTAPEKGKE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057010 |
| RefSeq Size | 1403 |
| RefSeq ORF | 939 |
| Synonyms | ZSIG11 |
| Locus ID | 51368 |
| Cytogenetics | 3p21.2 |
| Summary | Major reticulophagy (also called ER-phagy) receptor that acts independently of other candidate reticulophagy receptors to remodel subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover (PubMed:31006538, PubMed:31006537). The ATG8-containing isolation membrane (IM) cradles a tubular segment of TEX264-positive ER near a three-way junction, allowing the formation of a synapse of 2 juxtaposed membranes with trans interaction between the TEX264 and ATG8 proteins (PubMed:31006537). Expansion of the IM would extend the capture of ER, possibly through a 'zipper-like' process involving continued trans TEX264-ATG8 interactions, until poorly understood mechanisms lead to the fission of relevant membranes and, ultimately, autophagosomal membrane closure (PubMed:31006537).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Secreted Protein, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414327 | TEX264 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427069 | TEX264 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414327 | Transient overexpression lysate of testis expressed 264 (TEX264), transcript variant 1 |
CNY 3080.00 |
|
| LY427069 | Transient overexpression lysate of testis expressed 264 (TEX264), transcript variant 2 |
CNY 3080.00 |
|
| TP300008 | Recombinant protein of human testis expressed 264 (TEX264), transcript variant 1, 20 µg |
CNY 2900.00 |
