SIRPB1 (NM_001135844) Human Mass Spec Standard
CAT＃: PH326750
SIRPB1 MS Standard C13 and N15-labeled recombinant protein (NP_001129316)
View other "SIRPB1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Product images
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | SIRPB1 MS Standard C13 and N15-labeled recombinant protein (NP_001129316) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC226750 |
| Predicted MW | 43.2 kDa |
| Protein Sequence |
>RC226750 representing NM_001135844
Red=Cloning site Green=Tags(s) MPVPASWPHLPSPFLLMTLLLGRLTGVAGEDELQVIQPEKSVSVAAGESATLCCAMTSLIPVGPIMWFRG AGAGRELIYNQKEGHFPRVTTVSELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAGTE LSVRAKPSAPVVSGPAVRATPEHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPAGDSVSYSIHS TARVVLTRGDVHSQVICEMAHITLQGDPLRGTANLSEAIRVPPTLEVTQQPMRAENQANVTCQVSNFYPR GLQLTWLENGNVSRTETASTLIENKDGTYNWMSWLLVNTCAHRDDVVLTCQVEHDGQQAVSKSYALEISA HQKEHGSDITHEPALAPTAPLLVALLLGPKLLLVVGVSAIYICWKQKA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001129316 |
| RefSeq ORF | 1194 |
| Synonyms | CD172b; SIRP-BETA-1 |
| Locus ID | 10326 |
| Cytogenetics | 20p13 |
| Summary | The protein encoded by this gene is a member of the signal-regulatory-protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. This protein was found to interact with TYROBP/DAP12, a protein bearing immunoreceptor tyrosine-based activation motifs. This protein was also reported to participate in the recruitment of tyrosine kinase SYK. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2009] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416898 | SIRPB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427721 | SIRPB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416898 | Transient overexpression lysate of signal-regulatory protein beta 1 (SIRPB1), transcript variant 1 |
CNY 3080.00 |
|
| LY427721 | Transient overexpression lysate of signal-regulatory protein beta 1 (SIRPB1), transcript variant 3 |
CNY 3080.00 |
|
| PH311765 | SIRPB1 MS Standard C13 and N15-labeled recombinant protein (NP_006056) |
CNY 19520.00 |
|
| TP311765 | Recombinant protein of human signal-regulatory protein beta 1 (SIRPB1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP326750 | Purified recombinant protein of Homo sapiens signal-regulatory protein beta 1 (SIRPB1), transcript variant 3, 20 µg |
CNY 2900.00 |
