SIRPB1 (NM_006065) Human Mass Spec Standard
CAT#: PH311765
SIRPB1 MS Standard C13 and N15-labeled recombinant protein (NP_006056)
View other "SIRPB1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | SIRPB1 MS Standard C13 and N15-labeled recombinant protein (NP_006056) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211765 |
Predicted MW | 43.2 kDa |
Protein Sequence |
>RC211765 representing NM_006065
Red=Cloning site Green=Tags(s) MPVPASWPHLPSPFLLMTLLLGRLTGVAGEDELQVIQPEKSVSVAAGESATLCCAMTSLIPVGPIMWFRG AGAGRELIYNQKEGHFPRVTTVSELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAGTE LSVRAKPSAPVVSGPAVRATPEHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPAGDSVSYSIHS TARVVLTRGDVHSQVICEMAHITLQGDPLRGTANLSEAIRVPPTLEVTQQPMRAENQANVTCQVSNFYPR GLQLTWLENGNVSRTETASTLIENKDGTYNWMSWLLVNTCAHRDDVVLTCQVEHDGQQAVSKSYALEISA HQKEHGSDITHEPALAPTAPLLVALLLGPKLLLVVGVSAIYICWKQKA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006056 |
RefSeq Size | 3804 |
RefSeq ORF | 1194 |
Synonyms | CD172b; SIRP-BETA-1 |
Locus ID | 10326 |
Cytogenetics | 20p13 |
Summary | The protein encoded by this gene is a member of the signal-regulatory-protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. This protein was found to interact with TYROBP/DAP12, a protein bearing immunoreceptor tyrosine-based activation motifs. This protein was also reported to participate in the recruitment of tyrosine kinase SYK. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2009] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416898 | SIRPB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427721 | SIRPB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416898 | Transient overexpression lysate of signal-regulatory protein beta 1 (SIRPB1), transcript variant 1 |
CNY 3080.00 |
|
LY427721 | Transient overexpression lysate of signal-regulatory protein beta 1 (SIRPB1), transcript variant 3 |
CNY 3080.00 |
|
PH326750 | SIRPB1 MS Standard C13 and N15-labeled recombinant protein (NP_001129316) |
CNY 14250.00 |
|
TP311765 | Recombinant protein of human signal-regulatory protein beta 1 (SIRPB1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP326750 | Purified recombinant protein of Homo sapiens signal-regulatory protein beta 1 (SIRPB1), transcript variant 3, 20 µg |
CNY 2900.00 |