KGF (FGF7) (NM_002009) Human Mass Spec Standard
CAT#: PH324418
FGF7 MS Standard C13 and N15-labeled recombinant protein (NP_002000)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | FGF7 MS Standard C13 and N15-labeled recombinant protein (NP_002000) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224418 |
Predicted MW | 22.51 kDa |
Protein Sequence |
>RC224418 representing NM_002009
Red=Cloning site Green=Tags(s) MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLF CRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFK ELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002000 |
RefSeq Size | 3853 |
RefSeq ORF | 582 |
Synonyms | HBGF-7; KGF |
Locus ID | 2252 |
Cytogenetics | 15q21.2 |
Summary | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is a potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblasts and endothelial cells. Studies of mouse and rat homologs of this gene implicated roles in morphogenesis of epithelium, reepithelialization of wounds, hair development and early lung organogenesis. [provided by RefSeq, Jul 2008] |
Protein Families | Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Secreted Protein |
Protein Pathways | MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400734 | FGF7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400734 | Transient overexpression lysate of fibroblast growth factor 7 (keratinocyte growth factor) (FGF7) |
CNY 3080.00 |
|
TP324418 | Recombinant protein of human fibroblast growth factor 7 (keratinocyte growth factor) (FGF7), 20 µg |
CNY 2900.00 |
|
TP721204 | Purified recombinant protein of Human fibroblast growth factor 7 (FGF7) |
CNY 1800.00 |
|
TP750010 | Recombinant protein of human Fibroblast Growth Factor-7 (KGF) produced in E. coli. |
CNY 4020.00 |