United States
Germany
Japan
United Kingdom
China
NOXO1 (NM_172168) Human Mass Spec Standard
CAT＃: PH323385
NOXO1 MS Standard C13 and N15-labeled recombinant protein (NP_751908)
View other "NOXO1" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Product images
Specifications
| Product Data | |
| Description | NOXO1 MS Standard C13 and N15-labeled recombinant protein (NP_751908) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC223385 |
| Predicted MW | 41.1 kDa |
| Protein Sequence |
>RC223385 representing NM_172168
Red=Cloning site Green=Tags(s) MAGPRYPVSVQGAALVQIKRLQTFAFSVRWSDGSDTFVRRSWDEFRQLKKTLKETFPVEAGLLRRSDRVL PKLLGQASLDAPLLGRVGRTSRGLARLQLLETYSRRLLATAERVARSPTITGFFAPQPLDLEPALPPGSR VILPTPEEQPLSRAAGRLSIHSLEAQSLRCLQPFCTQDTRDRPFQAQAQESLDVLLRHPSGWWLVENEDR QTAWFPAPYLEEAAPGQGREGGPSLGSSGPQFCASRAYESSRADELSVPAGARVRVLETSDRGWWLCRYG DRAGLLPAVLLRPEGLGALLSGTGFRGGDDPAGEARGFPEPSQATAPPPTVPTRPSPGAIQSRCCTVTRR ALERRPRRQGRPRGCVDSVPHPTTEQ SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_751908 |
| RefSeq Size | 1147 |
| RefSeq ORF | 1128 |
| Synonyms | P41NOX; P41NOXA; P41NOXB; P41NOXC; SH3PXD5; SNX28 |
| Locus ID | 124056 |
| Cytogenetics | 16p13.3 |
| Summary | This gene encodes an NADPH oxidase (NOX) organizer, which positively regulates NOX1 and NOX3. The protein contains a PX domain and two SH3 domains. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jun 2012] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403398 | NOXO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406778 | NOXO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406779 | NOXO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC430349 | NOXO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403398 | Transient overexpression lysate of NADPH oxidase organizer 1 (NOXO1), transcript variant a |
CNY 3,080.00 |
|
| LY406778 | Transient overexpression lysate of NADPH oxidase organizer 1 (NOXO1), transcript variant b |
CNY 3,080.00 |
|
| LY406779 | Transient overexpression lysate of NADPH oxidase organizer 1 (NOXO1), transcript variant c |
CNY 3,080.00 |
|
| PH314973 | NOXO1 MS Standard C13 and N15-labeled recombinant protein (NP_751907) |
CNY 19,520.00 |
|
| TP314973 | Recombinant protein of human NADPH oxidase organizer 1 (NOXO1), transcript variant b, 20 µg |
CNY 2,900.00 |
|
| TP323385 | Purified recombinant protein of Homo sapiens NADPH oxidase organizer 1 (NOXO1), transcript variant c, 20 µg |
CNY 2,900.00 |
|
| TP761645 | Purified recombinant protein of Human NADPH oxidase organizer 1 (NOXO1), transcript variant a, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
