NOXO1 (NM_172167) Human Mass Spec Standard
CAT#: PH314973
NOXO1 MS Standard C13 and N15-labeled recombinant protein (NP_751907)
View other "NOXO1" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | NOXO1 MS Standard C13 and N15-labeled recombinant protein (NP_751907) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214973 |
Predicted MW | 40.6 kDa |
Protein Sequence |
>RC214973 representing NM_172167
Red=Cloning site Green=Tags(s) MAGPRYPVSVQGAALVQIKRLQTFAFSVRWSDGSDTFVRRSWDEFRQLKTLKETFPVEAGLLRRSDRVLP KLLDAPLLGRVGRTSRGLARLQLLETYSRRLLATAERVARSPTITGFFAPQPLDLEPALPPGSRVILPTP EEQPLSRAAGRLSIHSLEAQSLRCLQPFCTQDTRDRPFQAQAQESLDVLLRHPSGWWLVENEDRQTAWFP APYLEEAAPGQGREGGPSLGSSGPQFCASRAYESSRADELSVPAGARVRVLETSDRGWWLCRYGDRAGLL PAVLLRPEGLGALLSGTGFRGGDDPAGEARGFPEPSQATAPPPTVPTRPSPGAIQSRCCTVTRRALERRP RRQGRPRGCVDSVPHPTTEQ SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_751907 |
RefSeq Size | 1132 |
RefSeq ORF | 1113 |
Synonyms | P41NOX; P41NOXA; P41NOXB; P41NOXC; SH3PXD5; SNX28 |
Locus ID | 124056 |
Cytogenetics | 16p13.3 |
Summary | This gene encodes an NADPH oxidase (NOX) organizer, which positively regulates NOX1 and NOX3. The protein contains a PX domain and two SH3 domains. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jun 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403398 | NOXO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC406778 | NOXO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC406779 | NOXO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC430349 | NOXO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403398 | Transient overexpression lysate of NADPH oxidase organizer 1 (NOXO1), transcript variant a |
CNY 3080.00 |
|
LY406778 | Transient overexpression lysate of NADPH oxidase organizer 1 (NOXO1), transcript variant b |
CNY 3080.00 |
|
LY406779 | Transient overexpression lysate of NADPH oxidase organizer 1 (NOXO1), transcript variant c |
CNY 3080.00 |
|
PH323385 | NOXO1 MS Standard C13 and N15-labeled recombinant protein (NP_751908) |
CNY 14250.00 |
|
TP314973 | Recombinant protein of human NADPH oxidase organizer 1 (NOXO1), transcript variant b, 20 µg |
CNY 2900.00 |
|
TP323385 | Purified recombinant protein of Homo sapiens NADPH oxidase organizer 1 (NOXO1), transcript variant c, 20 µg |
CNY 2900.00 |
|
TP761645 | Purified recombinant protein of Human NADPH oxidase organizer 1 (NOXO1), transcript variant a, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2040.00 |