MATK (NM_139355) Human Mass Spec Standard
CAT#: PH323161
MATK MS Standard C13 and N15-labeled recombinant protein (NP_647612)
View other "MATK" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | MATK MS Standard C13 and N15-labeled recombinant protein (NP_647612) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223161 |
Predicted MW | 56.3 kDa |
Protein Sequence |
>RC223161 representing NM_139355
Red=Cloning site Green=Tags(s) MAGRGSLVSWRAFHGCDSAEELPRVSPRFLRAWHPPPVSARMPTRRWAPGTQCITKCEHTRPKPGELAFR KGDVVTILEACENKSWYRVKHHTSGQEGLLAAGALREREALSADPKLSLMPWFHGKISGQEAVQQLQPPE DGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDEAVFFCNLMDMVEHYSKDKGAICTKLVRP KRKHGTKSAEEELARAGWLLNLQHLTLGAQIGEGEFGAVLQGEYLGQKVAVKNIKCDVTAQAFLDETAVM TKMQHENLVRLLGVILHQGLYIVMEHVSKGNLVNFLRTRGRALVNTAQLLQFSLHVAEGMEYLESKKLVH RDLAARNILVSEDLVAKVSDFGLAKAERKGLDSSRLPVKWTAPEALKHGKFTSKSDVWSFGVLLWEVFSY GRAPYPKMSLKEVSEAVEKGYRMEPPEGCPGPVHVLMSSCWEAEPARRPPFRKLAEKLARELRSAGAPAS VSGQDADGSTSPRSQEP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_647612 |
RefSeq Size | 2183 |
RefSeq ORF | 1521 |
Synonyms | CHK; CTK; HHYLTK; HYL; HYLTK; Lsk |
Locus ID | 4145 |
Cytogenetics | 19p13.3 |
Summary | The protein encoded by this gene has amino acid sequence similarity to Csk tyrosine kinase and has the structural features of the CSK subfamily: SRC homology SH2 and SH3 domains, a catalytic domain, a unique N terminus, lack of myristylation signals, lack of a negative regulatory phosphorylation site, and lack of an autophosphorylation site. This protein is thought to play a significant role in the signal transduction of hematopoietic cells. It is able to phosphorylate and inactivate Src family kinases, and may play an inhibitory role in the control of T-cell proliferation. This protein might be involved in signaling in some cases of breast cancer. Three alternatively spliced transcript variants that encode different isoforms have been described for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protein Kinase, Stem cell - Pluripotency |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408299 | MATK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC408300 | MATK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC419363 | MATK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY408299 | Transient overexpression lysate of megakaryocyte-associated tyrosine kinase (MATK), transcript variant 3 |
CNY 3080.00 |
|
LY408300 | Transient overexpression lysate of megakaryocyte-associated tyrosine kinase (MATK), transcript variant 1 |
CNY 4840.00 |
|
LY419363 | Transient overexpression lysate of megakaryocyte-associated tyrosine kinase (MATK), transcript variant 2 |
CNY 4840.00 |
|
PH300454 | MATK MS Standard C13 and N15-labeled recombinant protein (NP_647611) |
CNY 19520.00 |
|
TP300454 | Recombinant protein of human megakaryocyte-associated tyrosine kinase (MATK), transcript variant 3, 20 µg |
CNY 2900.00 |
|
TP323161 | Recombinant protein of human megakaryocyte-associated tyrosine kinase (MATK), transcript variant 1, 20 µg |
CNY 2900.00 |