ASIP (NM_001672) Human Mass Spec Standard
CAT#: PH322654
ASIP MS Standard C13 and N15-labeled recombinant protein (NP_001663)
View other "ASIP" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | ASIP MS Standard C13 and N15-labeled recombinant protein (NP_001663) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222654 |
Predicted MW | 14.52 kDa |
Protein Sequence |
>RC222654 representing NM_001672
Red=Cloning site Green=Tags(s) MDVTRLLLATLLVFLCFFTANSHLPPEEKLRDDRSLRSNSSVNLLDVPSVSIVALNKKSKQIGRKAAEKK RSSKKEASMKKVVRPRTPLSAPCVATRNSCKPPAPACCDPCASCQCRFFRSACSCRVLSLNC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001663 |
RefSeq Size | 584 |
RefSeq ORF | 396 |
Synonyms | AGSW; AGTI; AGTIL; ASP; SHEP9 |
Locus ID | 434 |
Cytogenetics | 20q11.22 |
Summary | In mice, the agouti gene encodes a paracrine signaling molecule that causes hair follicle melanocytes to synthesize pheomelanin, a yellow pigment, instead of the black or brown pigment, eumelanin. Pleiotropic effects of constitutive expression of the mouse gene include adult-onset obesity, increased tumor susceptibility, and premature infertility. This gene is highly similar to the mouse gene and encodes a secreted protein that may (1) affect the quality of hair pigmentation, (2) act as a pharmacological antagonist of alpha-melanocyte-stimulating hormone, (3) play a role in neuroendocrine aspects of melanocortin action, and (4) have a functional role in regulating lipid metabolism in adipocytes. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Protein Pathways | Melanogenesis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419812 | ASIP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419812 | Transient overexpression lysate of agouti signaling protein, nonagouti homolog (mouse) (ASIP) |
CNY 3080.00 |
|
TP322654 | Recombinant protein of human agouti signaling protein, nonagouti homolog (mouse) (ASIP), 20 µg |
CNY 2900.00 |
|
TP701037 | Purified recombinant protein of Human agouti signaling protein (ASIP), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug |
CNY 7106.00 |