ASIP (NM_001672) Human Tagged ORF Clone
CAT#: RC222654
ASIP (Myc-DDK-tagged)-Human agouti signaling protein (ASIP)
ORF Plasmid: tGFP
"NM_001672" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,800.00
CNY 4,180.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | AGSW; AGTI; AGTIL; ASP; SHEP9 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC222654 representing NM_001672
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGATGTCACCCGCTTACTCCTGGCCACCCTGCTGGTCTTCCTCTGCTTCTTCACTGCCAACAGCCACC TGCCACCTGAGGAGAAGCTCCGAGATGACAGGAGCCTGAGAAGCAACTCCTCTGTGAACCTACTGGATGT CCCTTCTGTCTCTATTGTGGCGCTGAACAAGAAATCCAAACAGATCGGCAGAAAAGCAGCAGAAAAGAAA AGATCTTCTAAGAAGGAGGCTTCGATGAAGAAAGTGGTGCGGCCCCGGACCCCCCTATCTGCGCCCTGCG TGGCCACCCGCAACAGCTGCAAGCCGCCGGCACCCGCCTGCTGCGACCCGTGCGCCTCCTGCCAGTGCCG CTTCTTCCGCAGCGCCTGCTCCTGCCGCGTGCTCAGCCTCAACTGC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC222654 representing NM_001672
Red=Cloning site Green=Tags(s) MDVTRLLLATLLVFLCFFTANSHLPPEEKLRDDRSLRSNSSVNLLDVPSVSIVALNKKSKQIGRKAAEKK RSSKKEASMKKVVRPRTPLSAPCVATRNSCKPPAPACCDPCASCQCRFFRSACSCRVLSLNC myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_001672 |
ORF Size | 396 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001672.2, NP_001663.2 |
RefSeq Size | 584 bp |
RefSeq ORF | 399 bp |
Locus ID | 434 |
UniProt ID | P42127 |
Protein Families | Secreted Protein |
Protein Pathways | Melanogenesis |
MW | 14.52 kDa |
Gene Summary | In mice, the agouti gene encodes a paracrine signaling molecule that causes hair follicle melanocytes to synthesize pheomelanin, a yellow pigment, instead of the black or brown pigment, eumelanin. Pleiotropic effects of constitutive expression of the mouse gene include adult-onset obesity, increased tumor susceptibility, and premature infertility. This gene is highly similar to the mouse gene and encodes a secreted protein that may (1) affect the quality of hair pigmentation, (2) act as a pharmacological antagonist of alpha-melanocyte-stimulating hormone, (3) play a role in neuroendocrine aspects of melanocortin action, and (4) have a functional role in regulating lipid metabolism in adipocytes. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC222654L1 | Lenti ORF clone of Human agouti signaling protein (ASIP), Myc-DDK-tagged |
CNY 4,200.00 |
|
RC222654L2 | Lenti ORF clone of Human agouti signaling protein (ASIP), mGFP tagged |
CNY 5,890.00 |
|
RC222654L3 | Lenti ORF clone of Human agouti signaling protein (ASIP), Myc-DDK-tagged |
CNY 5,890.00 |
|
RC222654L4 | Lenti ORF clone of Human agouti signaling protein (ASIP), mGFP tagged |
CNY 5,890.00 |
|
RG222654 | ASIP (tGFP-tagged) - Human agouti signaling protein (ASIP) |
CNY 3,400.00 |
|
SC303053 | ASIP (untagged)-Human agouti signaling protein (ASIP) |
CNY 1,800.00 |