DPPA5 (NM_001025290) Human Mass Spec Standard
CAT#: PH322509
DPPA5 MS Standard C13 and N15-labeled recombinant protein (NP_001020461)
View other "DPPA5" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | DPPA5 MS Standard C13 and N15-labeled recombinant protein (NP_001020461) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC222509 |
| Predicted MW | 13.3 kDa |
| Protein Sequence |
>RC222509 representing NM_001025290
Red=Cloning site Green=Tags(s) MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQVSKAMLELKALESSDLTEVVV YGSYLYKLRTKWMLQSMAEWHRQRQERGMLKLAEAMNALELGPWMK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001020461 |
| RefSeq Size | 612 |
| RefSeq ORF | 348 |
| Synonyms | ESG1 |
| Locus ID | 340168 |
| Cytogenetics | 6q13 |
| Summary | This gene encodes a protein that may function in the control of cell pluripotency and early embryogenesis. Expression of this gene is a specific marker for pluripotent stem cells. Pseudogenes of this gene are located on the short arm of chromosome 10 and the long arm of chromosomes 14 and 19. [provided by RefSeq, Dec 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400405 | DPPA5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400405 | Transient overexpression lysate of developmental pluripotency associated 5 (DPPA5) |
CNY 3080.00 |
|
| TP322509 | Recombinant protein of human developmental pluripotency associated 5 (DPPA5), 20 µg |
CNY 2900.00 |
