DPPA5 (NM_001025290) Human Recombinant Protein
CAT#: TP322509M
Recombinant protein of human developmental pluripotency associated 5 (DPPA5), 100 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 9998.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC222509 representing NM_001025290
Red=Cloning site Green=Tags(s) MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQVSKAMLELKALESSDLTEVVV YGSYLYKLRTKWMLQSMAEWHRQRQERGMLKLAEAMNALELGPWMK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 13.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001020461 |
| Locus ID | 340168 |
| UniProt ID | A6NC42 |
| Refseq Size | 612 |
| Cytogenetics | 6q13 |
| Refseq ORF | 348 |
| Synonyms | ESG1 |
| Summary | This gene encodes a protein that may function in the control of cell pluripotency and early embryogenesis. Expression of this gene is a specific marker for pluripotent stem cells. Pseudogenes of this gene are located on the short arm of chromosome 10 and the long arm of chromosomes 14 and 19. [provided by RefSeq, Dec 2010] |
Documents
| FAQs |
| SDS |
