PACRG (NM_001080378) Human Mass Spec Standard
CAT＃: PH322240
PACRG MS Standard C13 and N15-labeled recombinant protein (NP_001073847)
View other "PACRG" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | PACRG MS Standard C13 and N15-labeled recombinant protein (NP_001073847) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC222240 |
| Predicted MW | 29.3 kDa |
| Protein Sequence |
>RC222240 protein sequence
Red=Cloning site Green=Tags(s) MVAEKETLSLNKCPDKMPKRTKLLAQQPLPVHQPHSLVSEGFTVKAMMKNSVVRGPPAAGAFKERPTKPT AFRKFYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLFFDGLCEMTFPYEFFARQGIHDMLEHGGN KILPVLPQLIIPIKNALNLRNRQVICVTLKVLQHLVVSAEMVGKALVPYYRQILPVLNIFKNMNVNSGDG IDYSQQKRENIGDLIQETLEAFERYGGENAFINIKYVVPTYESCLLN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001073847 |
| RefSeq Size | 1585 |
| RefSeq ORF | 771 |
| Synonyms | GLUP; HAK005771; PACRG2.1; PARK2CRG |
| Locus ID | 135138 |
| Cytogenetics | 6q26 |
| Summary | This gene encodes a protein that is conserved across metazoans. In vertebrates, this gene is linked in a head-to-head arrangement with the adjacent parkin gene, which is associated with autosomal recessive juvenile Parkinson's disease. These genes are co-regulated in various tissues and they share a bi-directional promoter. Both genes are associated with susceptibility to leprosy. The parkin co-regulated gene protein forms a large molecular complex with chaperones, including heat shock proteins 70 and 90, and chaperonin components. This protein is also a component of Lewy bodies in Parkinson's disease patients, and it suppresses unfolded Pael receptor-induced neuronal cell death. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407578 | PACRG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421606 | PACRG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421607 | PACRG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407578 | Transient overexpression lysate of PARK2 co-regulated (PACRG), transcript variant 1 |
CNY 3080.00 |
|
| LY421606 | Transient overexpression lysate of PARK2 co-regulated (PACRG), transcript variant 2 |
CNY 3080.00 |
|
| LY421607 | Transient overexpression lysate of PARK2 co-regulated (PACRG), transcript variant 3 |
CNY 3080.00 |
|
| TP322240 | Recombinant protein of human PARK2 co-regulated (PACRG), transcript variant 2, 20 µg |
CNY 2900.00 |
Recombinant protein of human PARK2 co-regulated (PACRG), transcript variant 2, 100 µg
