CHMP4A (NM_014169) Human Mass Spec Standard
CAT#: PH322002
CHMP4A MS Standard C13 and N15-labeled recombinant protein (NP_054888)
View other "CHMP4A" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | CHMP4A MS Standard C13 and N15-labeled recombinant protein (NP_054888) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222002 |
Predicted MW | 29.8 kDa |
Protein Sequence |
>RC222002 protein sequence
Red=Cloning site Green=Tags(s) MSRRRPEDGLGKAGPCVMRHHPPRSKAEVWRTLRGGGGRGELAMSGLGRLFGKGKKEKGPTPEEAIQKLK ETEKILIKKQEFLEQKIQQELQTAKKYGTKNKRAALQALRRKKRFEQQLAQTDGTLSTLEFQREAIENAT TNAEVLRTMELAAQSMKKAYQDMDIDKVDELMTDITEQQEVAQQISDAISRPMGFGDDVDEDELLEELEE LEQEELAQELLNVGDKEEEPSVKLPSVPSTHLPAGPAPKVDEDEEALKQLAEWVS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_054888 |
RefSeq Size | 1372 |
RefSeq ORF | 795 |
Synonyms | C14orf123; CHMP4; CHMP4B; HSPC134; SHAX2; SNF7; SNF7-1; VPS32-1; VPS32A |
Locus ID | 29082 |
Cytogenetics | 14q12 |
Summary | CHMP4A belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).[supplied by OMIM, Mar 2008] |
Protein Pathways | Endocytosis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415459 | CHMP4A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415459 | Transient overexpression lysate of chromatin modifying protein 4A (CHMP4A) |
CNY 3080.00 |
|
TP322002 | Recombinant protein of human chromatin modifying protein 4A (CHMP4A), 20 µg |
CNY 2900.00 |