MAFG (NM_002359) Human Mass Spec Standard
CAT#: PH321486
MAFG MS Standard C13 and N15-labeled recombinant protein (NP_002350)
View other "MAFG" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | MAFG MS Standard C13 and N15-labeled recombinant protein (NP_002350) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC221486 |
| Predicted MW | 17.7 kDa |
| Protein Sequence |
>RC221486 representing NM_002359
Red=Cloning site Green=Tags(s) MTTPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIVQLKQRRRTLKNRGYAASCRV KRVTQKEELEKQKAELQQEVEKLASENASMKLELDALRSKYEALQTFARTVARSPVAPARGPLAAGLGPL VPGKVAATSVITIVKSKTDARS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002350 |
| RefSeq Size | 5043 |
| RefSeq ORF | 486 |
| Synonyms | hMAF |
| Locus ID | 4097 |
| Cytogenetics | 17q25.3 |
| Summary | Globin gene expression is regulated through nuclear factor erythroid-2 (NFE2) elements located in enhancer-like locus control regions positioned many kb upstream of alpha- and beta-gene clusters (summarized by Blank et al., 1997 [PubMed 9166829]). NFE2 DNA-binding activity consists of a heterodimer containing a ubiquitous small Maf protein (MafF, MIM 604877; MafG; or MafK, MIM 600197) and the tissue-restricted protein p45 NFE2 (MIM 601490). Both subunits are members of the activator protein-1-like superfamily of basic leucine zipper (bZIP) proteins (see MIM 165160).[supplied by OMIM, Mar 2010] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409976 | MAFG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419371 | MAFG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409976 | Transient overexpression lysate of v-maf musculoaponeurotic fibrosarcoma oncogene homolog G (avian) (MAFG), transcript variant 2 |
CNY 3080.00 |
|
| LY419371 | Transient overexpression lysate of v-maf musculoaponeurotic fibrosarcoma oncogene homolog G (avian) (MAFG), transcript variant 1 |
CNY 3080.00 |
|
| TP321486 | Recombinant protein of human v-maf musculoaponeurotic fibrosarcoma oncogene homolog G (avian) (MAFG), transcript variant 1, 20 µg |
CNY 2900.00 |
