MAFG (NM_002359) Human Tagged ORF Clone
CAT#: RC221486
MAFG (Myc-DDK-tagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog G (avian) (MAFG), transcript variant 1
ORF Plasmid: tGFP
"NM_002359" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,990.00
Cited in 2 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | hMAF |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC221486 representing NM_002359
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGACGACCCCCAATAAAGGAAACAAGGCCTTGAAGGTGAAGCGGGAGCCGGGTGAGAATGGCACCAGCC TGACGGATGAGGAGCTGGTGACCATGTCGGTGCGGGAGCTGAACCAGCACCTGCGGGGCCTGTCCAAGGA GGAGATCGTCCAGCTGAAGCAGCGCCGGCGCACGCTCAAGAACCGCGGCTACGCTGCCAGCTGCCGCGTG AAGCGGGTGACGCAGAAGGAGGAGCTGGAGAAGCAGAAGGCGGAGCTGCAGCAGGAGGTGGAGAAGCTGG CCTCAGAGAACGCCAGCATGAAGCTGGAGCTCGACGCGCTGCGCTCCAAGTACGAGGCGCTGCAGACCTT CGCCCGGACGGTGGCCCGCAGCCCCGTGGCGCCAGCCCGGGGCCCCCTTGCCGCCGGCCTGGGGCCCCTC GTCCCAGGCAAGGTGGCCGCCACCAGCGTCATCACAATAGTAAAGTCCAAGACGGATGCCCGATCG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC221486 representing NM_002359
Red=Cloning site Green=Tags(s) MTTPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIVQLKQRRRTLKNRGYAASCRV KRVTQKEELEKQKAELQQEVEKLASENASMKLELDALRSKYEALQTFARTVARSPVAPARGPLAAGLGPL VPGKVAATSVITIVKSKTDARS myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_002359 |
ORF Size | 486 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_002359.4 |
RefSeq Size | 5043 bp |
RefSeq ORF | 489 bp |
Locus ID | 4097 |
UniProt ID | O15525 |
Domains | bZIP_Maf, BRLZ |
Protein Families | Druggable Genome, Transcription Factors |
MW | 17.7 kDa |
Gene Summary | Globin gene expression is regulated through nuclear factor erythroid-2 (NFE2) elements located in enhancer-like locus control regions positioned many kb upstream of alpha- and beta-gene clusters (summarized by Blank et al., 1997 [PubMed 9166829]). NFE2 DNA-binding activity consists of a heterodimer containing a ubiquitous small Maf protein (MafF, MIM 604877; MafG; or MafK, MIM 600197) and the tissue-restricted protein p45 NFE2 (MIM 601490). Both subunits are members of the activator protein-1-like superfamily of basic leucine zipper (bZIP) proteins (see MIM 165160).[supplied by OMIM, Mar 2010] |
Citations (2)
The use of this cDNA Clones has been cited in the following citations: |
---|
MAPK-induced miR-29 restrains melanoma progression by targeting MAFG
,Vera, O;Bok, I;Jasani, N;Nakamura, K;Xu, X;Mecozzi, N;,
bioRxiv
[MAFG]
|
MAFG is a potential therapeutic target to restore chemosensitivity in cisplatin-resistant cancer cells by increasing reactive oxygen species
,Vera-Puente, O;Rodriguez-Antolin, C;Salgado-Figueroa, A;Michalska, P;Pernia, O;Reid, BM;Rosas, R;Garcia-Guede, A;SacristÁn, S;Esteban-Rodriguez, I;Martin, ME;Sellers, TA;León, R;Gonzalez, VM;De Castro, J;de Caceres, II;,
Transl Res
,PubMed ID 30053382
[MAFG]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC221486L1 | Lenti ORF clone of Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog G (avian) (MAFG), transcript variant 1, Myc-DDK-tagged |
CNY 3,600.00 |
|
RC221486L2 | Lenti ORF clone of Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog G (avian) (MAFG), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RC221486L3 | Lenti ORF clone of Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog G (avian) (MAFG), transcript variant 1, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC221486L4 | Lenti ORF clone of Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog G (avian) (MAFG), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RG221486 | MAFG (tGFP-tagged) - Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog G (avian) (MAFG), transcript variant 1 |
CNY 4,370.00 |
|
SC118695 | MAFG (untagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog G (avian) (MAFG), transcript variant 1 |
CNY 1,200.00 |