RBPMS2 (NM_194272) Human Mass Spec Standard
CAT#: PH319559
RBPMS2 MS Standard C13 and N15-labeled recombinant protein (NP_919248)
View other "RBPMS2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | RBPMS2 MS Standard C13 and N15-labeled recombinant protein (NP_919248) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219559 |
Predicted MW | 22.3 kDa |
Protein Sequence |
>RC219559 representing NM_194272
Red=Cloning site Green=Tags(s) MSNLKPDGEHGGSTGTGSGAGSGGALEEEVRTLFVSGLPVDIKPRELYLLFRPFKGYEGSLIKLTARQPV GFVIFDSRAGAEAAKNALNGIRFDPENPQTLRLEFAKANTKMAKSKLMATPNPSNVHPALGAHFIARDPY DLMGAALIPASPEAWAPYPLYTTELTPAISHAAFTYPTATAAAAALHAQVRWYPSSDTTQQGWKYRQFC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_919248 |
RefSeq Size | 2019 |
RefSeq ORF | 627 |
Locus ID | 348093 |
Cytogenetics | 15q22.31 |
Summary | The protein encoded by this gene is a member of the RNA recognition motif (RRM)-containing protein family and is involved in the development and dedifferentiation of digestive smooth muscle cells. The encoded protein functions as a homodimer and indirectly inhibits the bone morphogenetic protein pathway. [provided by RefSeq, Aug 2016] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405113 | RBPMS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405113 | Transient overexpression lysate of RNA binding protein with multiple splicing 2 (RBPMS2) |
CNY 3080.00 |
|
TP319559 | Recombinant protein of human RNA binding protein with multiple splicing 2 (RBPMS2), 20 µg |
CNY 2900.00 |