RBPMS2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RBPMS2 antibody: synthetic peptide directed towards the middle region of human RBPMS2. Synthetic peptide located within the following region: ANTKMAKSKLMATPNPSNVHPALGAHFIARDPYDLMGAALIPASPEAWAP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	22 kDa
Gene Name	RNA binding protein with multiple splicing 2
Database Link	NP_919248 Entrez Gene 348093 Human UniProt ID Q6ZRY4
Background	RBPMS2 contains 1 RRM (RNA recognition motif) domain. The exact function of RBPMS2 remains unknown.
Synonyms	RNA-binding protein with multiple splicing 2; RNA binding protein with multiple splicing 2
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Zebrafish: 93%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Guinea pig: 86%; Bovine: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.