PDE6 gamma (PDE6G) (NM_002602) Human Mass Spec Standard
CAT#: PH316236
PDE6G MS Standard C13 and N15-labeled recombinant protein (NP_002593)
View other "PDE6 gamma" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | PDE6G MS Standard C13 and N15-labeled recombinant protein (NP_002593) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC216236 |
| Predicted MW | 9.6 kDa |
| Protein Sequence |
>RC216236 protein sequence
Red=Cloning site Green=Tags(s) MNLEPPKAEFRSATRVAGGPVTPRKGPPKFKQRQTRQFKSKPPKKGVQGFGDDIPGMEGLGTDITVICPW EAFNHLELHELAQYGII myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002593 |
| RefSeq Size | 1064 |
| RefSeq ORF | 261 |
| Synonyms | PDEG; RP57 |
| Locus ID | 5148 |
| Cytogenetics | 17q25.3 |
| Summary | This gene encodes the gamma subunit of cyclic GMP-phosphodiesterase, which is composed of alpha- and beta- catalytic subunits and two identical, inhibitory gamma subunits. This gene is expressed in rod photoreceptors and functions in the phototransduction signaling cascade. It is also expressed in a variety of other tissues, and has been shown to regulate the c-Src protein kinase and G-protein-coupled receptor kinase 2. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2009] |
| Protein Families | Druggable Genome |
| Protein Pathways | Progesterone-mediated oocyte maturation, Purine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419220 | PDE6G HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419220 | Transient overexpression lysate of phosphodiesterase 6G, cGMP-specific, rod, gamma (PDE6G), transcript variant 1 |
CNY 3080.00 |
|
| TP316236 | Recombinant protein of human phosphodiesterase 6G, cGMP-specific, rod, gamma (PDE6G), transcript variant 1, 20 µg |
CNY 2900.00 |
其它PDE6 gamma产品
