PDE6 gamma (PDE6G) (NM_002602) Human Recombinant Protein
CAT#: TP316236M
Recombinant protein of human phosphodiesterase 6G, cGMP-specific, rod, gamma (PDE6G), transcript variant 1, 100 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 9998.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC216236 protein sequence
Red=Cloning site Green=Tags(s) MNLEPPKAEFRSATRVAGGPVTPRKGPPKFKQRQTRQFKSKPPKKGVQGFGDDIPGMEGLGTDITVICPW EAFNHLELHELAQYGII myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 9.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002593 |
| Locus ID | 5148 |
| UniProt ID | P18545 |
| Refseq Size | 1064 |
| Cytogenetics | 17q25.3 |
| Refseq ORF | 261 |
| Synonyms | PDEG; RP57 |
| Summary | This gene encodes the gamma subunit of cyclic GMP-phosphodiesterase, which is composed of alpha- and beta- catalytic subunits and two identical, inhibitory gamma subunits. This gene is expressed in rod photoreceptors and functions in the phototransduction signaling cascade. It is also expressed in a variety of other tissues, and has been shown to regulate the c-Src protein kinase and G-protein-coupled receptor kinase 2. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2009] |
| Protein Families | Druggable Genome |
| Protein Pathways | Progesterone-mediated oocyte maturation, Purine metabolism |
Documents
| FAQs |
| SDS |
其它PDE6 gamma产品
