HSPB2 (NM_001541) Human Mass Spec Standard
CAT#: PH314718
HSPB2 MS Standard C13 and N15-labeled recombinant protein (NP_001532)
View other "HSPB2" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | HSPB2 MS Standard C13 and N15-labeled recombinant protein (NP_001532) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214718 |
Predicted MW | 20.2 kDa |
Protein Sequence |
>RC214718 protein sequence
Red=Cloning site Green=Tags(s) MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLS EGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDG ILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001532 |
RefSeq Size | 858 |
RefSeq ORF | 546 |
Synonyms | Hs.78846; HSP27; LOH11CR1K; MKBP |
Locus ID | 3316 |
Cytogenetics | 11q23.1 |
Summary | The protein encoded by this gene belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The protein is expressed preferentially in the heart and skeletal muscle. This protein regulates Myotonic Dystrophy Protein Kinase, which plays an important role in maintenance of muscle structure and function. [provided by RefSeq, Dec 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419871 | HSPB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419871 | Transient overexpression lysate of heat shock 27kDa protein 2 (HSPB2) |
CNY 3080.00 |
|
TP314718 | Recombinant protein of human heat shock 27kDa protein 2 (HSPB2), 20 µg |
CNY 2900.00 |
|
TP721195 | Purified recombinant protein of Human heat shock 27kDa protein 2 (HSPB2) |
CNY 3140.00 |