YY1 associated factor 2 (YAF2) (NM_005748) Human Mass Spec Standard
CAT#: PH314071
YAF2 MS Standard C13 and N15-labeled recombinant protein (NP_005739)
View other "YY1 associated factor 2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | YAF2 MS Standard C13 and N15-labeled recombinant protein (NP_005739) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214071 |
Predicted MW | 19.7 kDa |
Protein Sequence |
>RC214071 representing NM_005748
Red=Cloning site Green=Tags(s) MGDKKSPTRPKRQPKPSSDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTSTRKPRPVSQLVAQQVTQQFVP PTQSKKEKKDKVEKEKSEKETTSKKNSHKKTRPRLKNVDRSSAQHLEVTVGDLTVIITDFKEKTKSPPAS SAASADQHSQSGSSSDNTERGMSRSSSPRGEASSLNGESH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005739 |
RefSeq Size | 4096 |
RefSeq ORF | 540 |
Locus ID | 10138 |
Cytogenetics | 12q12 |
Summary | This gene encodes a zinc finger containing protein that functions in the regulation of transcription. This protein was identified as an interacting partner of transcriptional repressor protein Yy1, and also interacts with other transcriptional regulators, including Myc and Polycomb. This protein can promote proteolysis of Yy1. Multiple alternatively spliced transcript variants have been found. [provided by RefSeq, Feb 2016] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417096 | YAF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417096 | Transient overexpression lysate of YY1 associated factor 2 (YAF2) |
CNY 3080.00 |
|
TP314071 | Recombinant protein of human YY1 associated factor 2 (YAF2), 20 µg |
CNY 2900.00 |
其它YY1 associated factor 2产品