YY1 associated factor 2 (YAF2) Rabbit Polyclonal Antibody

CAT#: TA329295

Rabbit Polyclonal anti-YAF2 antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of YY1 associated factor 2 (YAF2)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human YY1 associated factor 2 (YAF2), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human YY1 associated factor 2 (YAF2), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-YAF2 antibody: synthetic peptide directed towards the middle region of human YAF2. Synthetic peptide located within the following region: KGTSTRKPRPVSQLVAQQVTQQFVPPTQSKKEKKDKVEKEKSEKETTSKK
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 20 kDa
Gene Name YY1 associated factor 2
Background YAF2 interacts with YY1, a zinc finger protein involved in negative regulation of muscle-restricted genes. YAF2 contains a single N-terminal C2-X10-C2 zinc finger, and in contrast to YY1, is up-regulated during myogenic differentiation. It also facilitates proteolytic cleavage of YY1 by the calcium- activated protease, m-calpain, suggesting a mechanism by which this protein antagonizes the negative effect of YY1.The protein encoded by this gene interacts with YY1, a zinc finger protein involved in negative regulation of muscle-restricted genes. This gene product itself contains a single N-terminal C2-X10-C2 zinc finger, and in contrast to YY1, is up-regulated during myogenic differentiation. It also facilitates proteolytic cleavage of YY1 by the calcium- activated protease, m-calpain, suggesting a mechanism by which this protein antagonizes the negative effect of YY1. Multiple transcript variants encoding different isoforms have been found for this gene, but the full-length nature of only two have been confirmed to date.
Synonyms DKFZp779H1820; MGC41856
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Mouse: 86%
Reference Data
Protein Families Druggable Genome, Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...