TrkC (NTRK3) (NM_002530) Human Mass Spec Standard
CAT#: PH313333
NTRK3 MS Standard C13 and N15-labeled recombinant protein (NP_002521)
View other "TrkC" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 4840.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | NTRK3 MS Standard C13 and N15-labeled recombinant protein (NP_002521) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC213333 |
| Predicted MW | 92.8 kDa |
| Protein Sequence |
>RC213333 representing NM_002530
Red=Cloning site Green=Tags(s) MDVSLCPAKCSFWRIFLLGSVWLDYVGSVLACPANCVCSKTEINCRRPDDGNLFPLLEGQDSGNSNGNAS INITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRSIQPRAFAKNPHLRYINLSSNRLT TLSWQLFQTLSLRELQLEQNFFNCSCDIRWMQLWQEQGEAKLNSQNLYCINADGSQLPLFRMNISQCDLP EISVSHVNLTVREGDNAVITCNGSGSPLPDVDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGF TLTCIAENVVGMSNASVALTVYYPPRVVSLEEPELRLEHCIEFVVRGNPPPTLHWLHNGQPLRESKIIHV EYYQEGEISEGCLLFNKPTHYNNGNYTLIAKNPLGTANQTINGHFLKEPFPESTDNFILFDEVSPTPPIT VTHKPEEDTFGVSIAVGLAAFACVLLVVLFVMINKYGRRSKFGMKGPVAVISGEEDSASPLHHINHGITT PSSLDAGPDTVVIGMTRIPVIENPQYFRQGHNCHKPDTYVQHIKRRDIVLKRELGEGAFGKVFLAECYNL SPTKDKMLVAVKALKDPTLAARKDFQREAELLTNLQHEHIVKFYGVCGDGDPLIMVFEYMKHGDLNKFLR AHGPDAMILVDGQPRQAKGELGLSQMLHIASQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGM SRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSFGVILWEIFTYGKQPWFQLSNTEVIECIT QGRVLERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002521 |
| RefSeq Size | 2818 |
| RefSeq ORF | 2475 |
| Synonyms | gp145(trkC); GP145-TrkC; TRKC |
| Locus ID | 4916 |
| Cytogenetics | 15q25.3 |
| Summary | This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation and may play a role in the development of proprioceptive neurons that sense body position. Mutations in this gene have been associated with medulloblastomas, secretory breast carcinomas and other cancers. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2011] |
| Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
| Protein Pathways | Neurotrophin signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400902 | NTRK3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY400902 | Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2 |
CNY 4840.00 |
|
| PH303781 | NTRK3 MS Standard C13 and N15-labeled recombinant protein (NP_001007157) |
CNY 19520.00 |
|
| PH319113 | NTRK3 MS Standard C13 and N15-labeled recombinant protein (NP_001012338) |
CNY 19520.00 |
|
| TP303781 | Recombinant protein of human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP313333 | Recombinant protein of human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP319113 | Recombinant protein of human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP700136 | Purified recombinant protein of human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 1, with C-terminal DDK/His tag, expressed in human cells, 20 µg |
CNY 6650.00 |
|
| TP710140 | Recombinant protein of human mitotic spindle organizing protein 2A (MZT2A), residues 32-429aa, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4020.00 |
