Chymotrypsin like protease (CTRL) (NM_001907) Human Mass Spec Standard
CAT#: PH309072
CTRL MS Standard C13 and N15-labeled recombinant protein (NP_001898)
View other "Chymotrypsin like protease" proteins (4)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
Specifications
| Product Data | |
| Description | CTRL MS Standard C13 and N15-labeled recombinant protein (NP_001898) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC209072 | 
| Predicted MW | 28 kDa | 
| Protein Sequence | 
                 >RC209072 protein sequence 
Red=Cloning site Green=Tags(s) MLLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWV VTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPV CLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSC QGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYN myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_001898 | 
| RefSeq Size | 1197 | 
| RefSeq ORF | 792 | 
| Synonyms | CTRL1 | 
| Locus ID | 1506 | 
| Cytogenetics | 16q22.1 | 
| Summary | This gene encodes a serine-type endopeptidase with chymotrypsin- and elastase-2-like activities. The gene encoding this zymogen is expressed specifically in the pancreas and likely functions as a digestive enzyme. [provided by RefSeq, Sep 2016] | 
| Protein Families | Druggable Genome, Protease | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC419665 | CTRL HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY419665 | Transient overexpression lysate of chymotrypsin-like (CTRL) | 
                                                     CNY 3080.00  | 
                                            |
| TP309072 | Recombinant protein of human chymotrypsin-like (CTRL), 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            |
| TP720385 | Recombinant protein of human chymotrypsin-like (CTRL) | 
                                                     CNY 1800.00  | 
                                            
其它Chymotrypsin like protease产品
