Chymotrypsin like protease (CTRL) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CTRL antibody: synthetic peptide directed towards the N terminal of human CTRL. Synthetic peptide located within the following region: LLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	chymotrypsin like
Database Link	NP_001898 Entrez Gene 1506 Human UniProt ID P40313
Background	CTRL contains 1 F-box domain. It is substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.The protein directly interacts with SKP1A and CUL1. A chromosomal aberration involving FBXO25 is a cause of X-linked mental retardation (XLMR).
Synonyms	CTRL1
Note	Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Pig: 92%; Mouse: 85%
Reference Data
Protein Families	Druggable Genome, Protease

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.