GIMAP1 (NM_130759) Human Mass Spec Standard
CAT#: PH308167
GIMAP1 MS Standard C13 and N15-labeled recombinant protein (NP_570115)
View other "GIMAP1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | GIMAP1 MS Standard C13 and N15-labeled recombinant protein (NP_570115) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208167 |
| Predicted MW | 34.4 kDa |
| Protein Sequence |
>RC208167 protein sequence
Red=Cloning site Green=Tags(s) MGGRKMATDEENVYGLEENAQSRQESTRRLILVGRTGAGKSATGNSILGQRRFFSRLGATSVTRACTTGS RRWDKCHVEVVDTPDIFSSQVSKTDPGCEERGHCYLLSAPGPHALLLVTQLGRFTAQDQQAVRQVRDMFG EDVLKWMVIVFTRKEDLAGGSLHDYVSNTENRALRELVAECGGRVCAFDNRATGREQEAQVEQLLGMVEG LVLEHKGAHYSNEVYELAQVLRWAGPEERLRRVAERVAARVQRRPWGAWLSARLWKWLKSPRSWRLGLAL LLGGALLFWVLLHRRWSEAVAEVGPD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_570115 |
| RefSeq Size | 4430 |
| RefSeq ORF | 918 |
| Synonyms | HIMAP1; IAN2; IMAP1; IMAP38 |
| Locus ID | 170575 |
| Cytogenetics | 7q36.1 |
| Summary | This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1. This gene is thought to be involved in the differentiation of T helper (Th) cells of the Th1 lineage, and the related mouse gene has been shown to be critical for the development of mature B and T lymphocytes. Read-through transcription exists between this gene and the downstream GIMAP5 (GTPase, IMAP family member 5) gene. [provided by RefSeq, Dec 2010] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408926 | GIMAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408926 | Transient overexpression lysate of GTPase, IMAP family member 1 (GIMAP1) |
CNY 3080.00 |
|
| TP308167 | Recombinant protein of human GTPase, IMAP family member 1 (GIMAP1), 20 µg |
CNY 2900.00 |
