GIMAP1 Rabbit Polyclonal Antibody
CAT#: TA342102
Rabbit Polyclonal Anti-GIMAP1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-GIMAP1 antibody: synthetic peptide directed towards the N terminal of human GIMAP1. Synthetic peptide located within the following region: MGGRKMATDEENVYGLEENAQSRQESTRRLILVGRTGAGKSATGNSILGQ |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 34 kDa |
Gene Name | GTPase, IMAP family member 1 |
Database Link | |
Background | GIMAP1 belonging toThe GTP-binding superfamily and toThe immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins.This gene encodes a protein belonging toThe GTP-binding superfamily and toThe immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans,The IAN subfamily genes are located in a cluster at 7q36.1. |
Synonyms | HIMAP1; IAN2; IMAP1; IMAP38 |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |