COMMD7 (NM_053041) Human Mass Spec Standard
CAT#: PH307984
COMMD7 MS Standard C13 and N15-labeled recombinant protein (NP_444269)
View other "COMMD7" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | COMMD7 MS Standard C13 and N15-labeled recombinant protein (NP_444269) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207984 |
| Predicted MW | 22.6 kDa |
| Protein Sequence |
>RC207984 protein sequence
Red=Cloning site Green=Tags(s) MGRLHCTEDPVPEAVGGDMQQLNQLGAQQFSALTEVLFHFLTEQKEVERFLAQLSEFATTNQISLGSLRS IVKSLLLVPNGALKKSLTAKQVQADFITLGLSEEKATYFSEKWKQNTPTLARWAIGQTLMINQLIDMEWK FGVTSGSSELEKVGSIFLQLKLVVKKGNQTKNVYIELTLPQFYSFLHEMERVRTSMECFC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_444269 |
| RefSeq Size | 1928 |
| RefSeq ORF | 600 |
| Synonyms | C20orf92; dJ1085F17.3 |
| Locus ID | 149951 |
| Cytogenetics | 20q11.21 |
| Summary | May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes (PubMed:21778237). Associates with the NF-kappa-B complex and suppresses its transcriptional activity (PubMed:15799966).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409337 | COMMD7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420436 | COMMD7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409337 | Transient overexpression lysate of COMM domain containing 7 (COMMD7), transcript variant 1 |
CNY 3080.00 |
|
| LY420436 | Transient overexpression lysate of COMM domain containing 7 (COMMD7), transcript variant 2 |
CNY 3080.00 |
|
| TP307984 | Recombinant protein of human COMM domain containing 7 (COMMD7), transcript variant 1, 20 µg |
CNY 2900.00 |
