HBLD1 (ISCA2) (NM_194279) Human Mass Spec Standard
CAT#: PH307304
ISCA2 MS Standard C13 and N15-labeled recombinant protein (NP_919255)
View other "HBLD1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | ISCA2 MS Standard C13 and N15-labeled recombinant protein (NP_919255) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207304 |
Predicted MW | 16.4 kDa |
Protein Sequence |
>RC207304 protein sequence
Red=Cloning site Green=Tags(s) MAAAWGSSLTAATQRAVTPWPRGRLLTASLGPQARREASSSSPEAGEGQICLTDSCVQRLLEITEGSEFL RLQVEGGGCSGFQYKFSLDTVINPDDRVFEQGGARVVVDSDSLAFVKGAQVDFSQELIRSSFQVLNNPQA QQGCSCGSSFSIKL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_919255 |
RefSeq Size | 1088 |
RefSeq ORF | 462 |
Synonyms | c14_5557; HBLD1; ISA2; MMDS4 |
Locus ID | 122961 |
Cytogenetics | 14q24.3 |
Summary | The protein encoded by this gene is an A-type iron-sulfur cluster (ISC) protein found in mitochondria. The encoded protein appears to be involved in the maturation of mitochondrial iron-sulfur proteins. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405117 | ISCA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405117 | Transient overexpression lysate of iron-sulfur cluster assembly 2 homolog (S. cerevisiae) (ISCA2) |
CNY 3080.00 |
|
TP307304 | Recombinant protein of human iron-sulfur cluster assembly 2 homolog (S. cerevisiae) (ISCA2), 20 µg |
CNY 2900.00 |