HBLD1 (ISCA2) Rabbit Polyclonal Antibody
CAT#: TA337604
Rabbit Polyclonal Anti-ISCA2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ISCA2 antibody: synthetic peptide directed towards the middle region of human ISCA2. Synthetic peptide located within the following region: RREASSSSPEAGEGQIRLTDSCVQRLLEITEGSEFLRLQVEGGGCSGFQY |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 16 kDa |
Gene Name | iron-sulfur cluster assembly 2 |
Database Link | |
Background | ISCA2 is involved in the assembly of mitochondrial iron-sulfur proteins. Probably involved in the binding of an intermediate of Fe/S cluster assembly. |
Synonyms | c14_5557; HBLD1; ISA2; MMDS4 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 93%; Rabbit: 92%; Dog: 86%; Horse: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |