FKBP11 (NM_016594) Human Mass Spec Standard
CAT#: PH306481
FKBP11 MS Standard C13 and N15-labeled recombinant protein (NP_057678)
View other "FKBP11" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | FKBP11 MS Standard C13 and N15-labeled recombinant protein (NP_057678) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206481 |
| Predicted MW | 22.2 kDa |
| Protein Sequence |
>RC206481 protein sequence
Red=Cloning site Green=Tags(s) MTLRPSLLPLHLLLLLLLSAAVCRAEAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVD GRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGKRGFPPSVPADAVVQYDVEL IALIRANYWLKLVKGILPLVGMAMVPALLGLIGYHLYRKANRPKVSKKKLKEEKRNKSKKK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057678 |
| RefSeq Size | 767 |
| RefSeq ORF | 603 |
| Synonyms | FKBP19 |
| Locus ID | 51303 |
| Cytogenetics | 12q13.12 |
| Summary | FKBP11 belongs to the FKBP family of peptidyl-prolyl cis/trans isomerases, which catalyze the folding of proline-containing polypeptides. The peptidyl-prolyl isomerase activity of FKBP proteins is inhibited by the immunosuppressant compounds FK506 and rapamycin (Rulten et al., 2006 [PubMed 16596453]).[supplied by OMIM, Mar 2008] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402578 | FKBP11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402578 | Transient overexpression lysate of FK506 binding protein 11, 19 kDa (FKBP11), transcript variant 1 |
CNY 3080.00 |
|
| TP306481 | Recombinant protein of human FK506 binding protein 11, 19 kDa (FKBP11), transcript variant 1, 20 µg |
CNY 2900.00 |
