FKBP11 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FKBP11 antibody: synthetic peptide directed towards the N terminal of human FKBP11. Synthetic peptide located within the following region: VRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	19 kDa
Gene Name	FK506 binding protein 11
Database Link	NP_057678 Entrez Gene 51303 Human UniProt ID Q9NYL4
Background	FKBP11 belongs toThe FKBP family of peptidyl-prolyl cis/trans isomerases, which catalyzeThe folding of proline-containing polypeptides.The peptidyl-prolyl isomerase activity of FKBP proteins is inhibited byThe immunosuppressant compounds FK506 and rapamycin (Rulten et al., 2006 [PubMed 16596453]). [supplied by OMIM, Mar 2008]. Transcript Variant:This variant (1) encodesThe longest isoform (1). ##Evidence-Data-START## Transcript exon combination :: AY358998.1, BC027973.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025087, ERS025093 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete onThe 3' end.
Synonyms	FKBP19
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Bovine: 93%; Goat: 83%; Zebrafish: 77%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.