Aquaporin 1 (AQP1) (NM_198098) Human Mass Spec Standard
CAT#: PH305304
AQP1 MS Standard C13 and N15-labeled recombinant protein (NP_932766)
View other "Aquaporin 1" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | AQP1 MS Standard C13 and N15-labeled recombinant protein (NP_932766) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205304 |
| Predicted MW | 28.6 kDa |
| Protein Sequence |
>RC205304 protein sequence
Red=Cloning site Green=Tags(s) MASEFKKKLFWRAVVAEFLATTLFVFISIGSALGFKYPVGNNQTTVQDNVKVSLAFGLSIATLAQSVGHI SGAHLNPAVTLGLLLSCQISIFRALMYIIAQCVGAIVATAILSGITSSLTGNSLGRNDLADGVNSGQGLG IEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGHLLAIDYTGCGINPARSFGSAVITHNFSNHW IFWVGPFIGGALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_932766 |
| RefSeq Size | 2807 |
| RefSeq ORF | 807 |
| Synonyms | AQP-CHIP; CHIP28; CO |
| Locus ID | 358 |
| Cytogenetics | 7p14.3 |
| Summary | This gene encodes a small integral membrane protein with six bilayer spanning domains that functions as a water channel protein. This protein permits passive transport of water along an osmotic gradient. This gene is a possible candidate for disorders involving imbalance in ocular fluid movement. [provided by RefSeq, Aug 2016] |
| Protein Families | Druggable Genome, Ion Channels: Other, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403670 | AQP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403670 | Transient overexpression lysate of aquaporin 1 (Colton blood group) (AQP1) |
CNY 3080.00 |
|
| TP305304 | Recombinant protein of human aquaporin 1 (Colton blood group) (AQP1), 20 µg |
CNY 2900.00 |
|
| TP329599 | Purified recombinant protein of Homo sapiens aquaporin 1 (Colton blood group) (AQP1), transcript variant 4, 20 µg |
CNY 2900.00 |
其它Aquaporin 1产品
