PDE6D (NM_002601) Human Mass Spec Standard
CAT#: PH303172
PDE6D MS Standard C13 and N15-labeled recombinant protein (NP_002592)
View other "PDE6D" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | PDE6D MS Standard C13 and N15-labeled recombinant protein (NP_002592) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203172 |
Predicted MW | 17.4 kDa |
Protein Sequence |
>RC203172 protein sequence
Red=Cloning site Green=Tags(s) MSAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSTEQ MEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLV STSRVRLFYV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002592 |
RefSeq Size | 1214 |
RefSeq ORF | 450 |
Synonyms | JBTS22; PDED |
Locus ID | 5147 |
Cytogenetics | 2q37.1 |
Summary | This gene encodes the delta subunit of rod-specific photoreceptor phosphodiesterase (PDE), a key enzyme in the phototransduction cascade. A similar protein in cow functions in solubilizing membrane-bound PDE. In addition to its role in the PDE complex, the encoded protein is thought to bind to prenyl groups of proteins to target them to subcellular organelles called cilia. Mutations in this gene are associated with Joubert syndrome-22. Alternative splicing results in multiple splice variants. [provided by RefSeq, Mar 2014] |
Protein Pathways | Progesterone-mediated oocyte maturation, Purine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419219 | PDE6D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419219 | Transient overexpression lysate of phosphodiesterase 6D, cGMP-specific, rod, delta (PDE6D) |
CNY 3080.00 |
|
TP303172 | Recombinant protein of human phosphodiesterase 6D, cGMP-specific, rod, delta (PDE6D), 20 µg |
CNY 2900.00 |
|
TP760649 | Purified recombinant protein of Human phosphodiesterase 6D, cGMP-specific, rod, delta (PDE6D), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
|
TP761964 | Purified recombinant protein of Human phosphodiesterase 6D, cGMP-specific, rod, delta (PDE6D),full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2050.00 |