PDE6D (NM_002601) Human Tagged ORF Clone
CAT#: RC203172
PDE6D (Myc-DDK-tagged)-Human phosphodiesterase 6D, cGMP-specific, rod, delta (PDE6D)
ORF Plasmid: tGFP
"NM_002601" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,800.00
CNY 3,705.00
Cited in 3 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | JBTS22; PDED |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC203172 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCAGCCAAGGACGAGCGGGCCAGGGAGATCCTGAGGGGCTTCAAACTAAATTGGATGAACCTTCGGG ATGCTGAGACAGGGAAGATACTCTGGCAAGGAACAGAAGACCTGTCTGTCCCTGGTGTGGAGCATGAAGC CCGTGTTCCCAAGAAAATCCTCAAGTGCAAGGCAGTGTCTCGAGAACTTAATTTTTCTTCGACAGAACAA ATGGAAAAATTCCGCCTGGAACAAAAAGTTTACTTCAAAGGGCAATGCCTAGAAGAATGGTTCTTCGAGT TTGGCTTTGTGATCCCTAACTCCACAAATACCTGGCAGTCCTTGATAGAGGCAGCACCCGAGTCCCAGAT GATGCCAGCAAGCGTCTTAACTGGGAACGTTATCATAGAAACAAAGTTTTTTGACGACGATCTTCTTGTA AGCACATCCAGAGTGAGACTTTTCTATGTT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC203172 protein sequence
Red=Cloning site Green=Tags(s) MSAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSTEQ MEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLV STSRVRLFYV myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_002601 |
ORF Size | 450 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_002601.4 |
RefSeq Size | 1214 bp |
RefSeq ORF | 453 bp |
Locus ID | 5147 |
UniProt ID | O43924 |
Protein Pathways | Progesterone-mediated oocyte maturation, Purine metabolism |
MW | 17.4 kDa |
Gene Summary | This gene encodes the delta subunit of rod-specific photoreceptor phosphodiesterase (PDE), a key enzyme in the phototransduction cascade. A similar protein in cow functions in solubilizing membrane-bound PDE. In addition to its role in the PDE complex, the encoded protein is thought to bind to prenyl groups of proteins to target them to subcellular organelles called cilia. Mutations in this gene are associated with Joubert syndrome-22. Alternative splicing results in multiple splice variants. [provided by RefSeq, Mar 2014] |
Citations (3)
The use of this cDNA Clones has been cited in the following citations: |
---|
The Delta Subunit of Rod-Specific Photoreceptor cGMP Phosphodiesterase (PDE6D) Contributes to Hepatocellular Carcinoma Progression
,Dietrich, P;Hellerbrand, C;Bosserhoff, A;,
Cancers (Basel) 2019
,PubMed ID 30901922
[PDE6D]
|
Identification of PDE6D as a molecular target of anecortave acetate via a methotrexate-anchored yeast three-hybrid screen.
,null,
ACS chemical biology
,PubMed ID 23301619
[PDE6D]
|
A homozygous PDE6D mutation in Joubert syndrome impairs targeting of farnesylated INPP5E protein to the primary cilium
,Thomas, S;Wright, KJ;Le Corre, S;Micalizzi, A;Romani, M;Abhyankar, A;Saada, J;Perrault, I;Amiel, J;Litzler, J;Filhol, E;Elkhartoufi, N;Kwong, M;Casanova, JL;Boddaert, N;Baehr, W;Lyonnet, S;Munnich, A;Burglen, L;Chassaing, N;Encha-Ravazi, F;Vekemans, M;Gleeson, JG;Valente, EM;Jackson, PK;Drummond, IA;Saunier, S;Attie-Bitach, T;,
Hum Mutat. 2013 Oct 25
,PubMed ID 24166846
[PDE6D]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC203172L1 | Lenti ORF clone of Human phosphodiesterase 6D, cGMP-specific, rod, delta (PDE6D), Myc-DDK-tagged |
CNY 4,200.00 |
|
RC203172L2 | Lenti ORF clone of Human phosphodiesterase 6D, cGMP-specific, rod, delta (PDE6D), mGFP tagged |
CNY 5,890.00 |
|
RC203172L3 | Lenti ORF clone of Human phosphodiesterase 6D, cGMP-specific, rod, delta (PDE6D), Myc-DDK-tagged |
CNY 5,890.00 |
|
RC203172L4 | Lenti ORF clone of Human phosphodiesterase 6D, cGMP-specific, rod, delta (PDE6D), mGFP tagged |
CNY 4,200.00 |
|
RG203172 | PDE6D (tGFP-tagged) - Human phosphodiesterase 6D, cGMP-specific, rod, delta (PDE6D) |
CNY 3,400.00 |
|
SC118535 | PDE6D (untagged)-Human phosphodiesterase 6D, cGMP-specific, rod, delta (PDE6D) |
CNY 1,800.00 |